Protein Info for BWI76_RS17550 in Klebsiella michiganensis M5al

Annotation: oxidoreductase (Fe-S)-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF13247: Fer4_11" amino acids 54 to 143 (90 residues), 42.5 bits, see alignment E=4e-14 PF12837: Fer4_6" amino acids 80 to 102 (23 residues), 27.5 bits, see alignment (E = 1.4e-09) PF00037: Fer4" amino acids 82 to 103 (22 residues), 29.3 bits, see alignment (E = 3.6e-10) PF13187: Fer4_9" amino acids 87 to 139 (53 residues), 28.3 bits, see alignment 9.2e-10 TIGR01318: glutamate synthase, small subunit" amino acids 178 to 640 (463 residues), 777.1 bits, see alignment E=2.5e-238 PF14691: Fer4_20" amino acids 194 to 304 (111 residues), 126.9 bits, see alignment E=2.1e-40 PF07992: Pyr_redox_2" amino acids 318 to 628 (311 residues), 81.2 bits, see alignment E=6.1e-26 PF00070: Pyr_redox" amino acids 318 to 389 (72 residues), 23.7 bits, see alignment E=3.7e-08 amino acids 459 to 534 (76 residues), 24.9 bits, see alignment E=1.5e-08 PF13450: NAD_binding_8" amino acids 321 to 355 (35 residues), 32.2 bits, see alignment (E = 7.2e-11)

Best Hits

Swiss-Prot: 67% identical to YGFT_ECOLI: Uncharacterized protein YgfT (ygfT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to cro:ROD_33931)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5A0 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BWI76_RS17550 oxidoreductase (Fe-S)-binding subunit (Klebsiella michiganensis M5al)
MNKFIVADSANCIGCHACEVACVTSHRQDCWPQQRSDFLPRIRVFFNRKASSATTCRHCN
DAPCVGSCPTQALSVANDSVQFTEALCIGCKNCVIACPFGAIEMVANDDDAPQLAQKCDL
CRQHPSGQQACVASCPTQALRLMDEAAVNQLRTARQIRSALERPLESVRGARRNAILNKP
PRVGAKKVPADDRLRHFGEIYQPLSERDAEYESERCLYCAQKAWCNWTCPLHNHIPDFIR
LVNEGKIIEAAELCHQSSSLPEICGRVCPQDRLCEGACTLKNEGGSVAIGNLERYITDTA
LAMGWRPTIDNVAPRPERVAVIGAGPAGLGCADILVRAGVHVDVFDRHPEIGGLLTFGIP
PFKLDKNVLERRRDVFSAMGVNFHLNQEVGRDVAFADLLKNYDAVFLGVGTYGLMAAGLE
GENAPGVIQALPFLIASTREVMGLEESAEYPLTDIKGKRVVVLGGGDTAMDCLRTAVRRG
AESVTCAYRRDELSMPGSKKEVVNAREEGVKFEFNVQPQRIQLNRKGQVCAVEMIRTKMG
DPGPDGRRRPQPIPDSGFELKADVLIMAFGFQAHEMPWLRGHGIKLDRWGQIVTGGKGRG
TTQTSHDKIFAGGDAVTGADLVVTAIVAGRQAASEMLAQFTAREEI