Protein Info for BWI76_RS17550 in Klebsiella michiganensis M5al

Annotation: oxidoreductase (Fe-S)-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 54 to 143 (90 residues), 42.5 bits, E=4e-14
• PF12837: Fer4_6
  • amino acids 80 to 102 (23 residues), 27.5 bits, see alignment (E = 1.4e-09)
• PF00037: Fer4
  • amino acids 82 to 103 (22 residues), 29.3 bits, see alignment (E = 3.6e-10)
• PF13187: Fer4_9
  • amino acids 87 to 139 (53 residues), 28.3 bits, 9.2e-10
• TIGR01318: glutamate synthase, small subunit
  • amino acids 178 to 640 (463 residues), 777.1 bits, E=2.5e-238
• PF14691: Fer4_20
  • amino acids 194 to 304 (111 residues), 126.9 bits, E=2.1e-40
• PF07992: Pyr_redox_2
  • amino acids 318 to 628 (311 residues), 81.2 bits, E=6.1e-26
• PF00070: Pyr_redox
  • amino acids 318 to 389 (72 residues), 23.7 bits, E=3.7e-08
  • amino acids 459 to 534 (76 residues), 24.9 bits, E=1.5e-08
• PF13450: NAD_binding_8
  • amino acids 321 to 355 (35 residues), 32.2 bits, see alignment (E = 7.2e-11)

Best Hits

Swiss-Prot: 67% identical to YGFT_ECOLI: Uncharacterized protein YgfT (ygfT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to cro:ROD_33931)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See A0A285B5A0 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BWI76_RS17550 oxidoreductase (Fe-S)-binding subunit (Klebsiella michiganensis M5al)
MNKFIVADSANCIGCHACEVACVTSHRQDCWPQQRSDFLPRIRVFFNRKASSATTCRHCN
DAPCVGSCPTQALSVANDSVQFTEALCIGCKNCVIACPFGAIEMVANDDDAPQLAQKCDL
CRQHPSGQQACVASCPTQALRLMDEAAVNQLRTARQIRSALERPLESVRGARRNAILNKP
PRVGAKKVPADDRLRHFGEIYQPLSERDAEYESERCLYCAQKAWCNWTCPLHNHIPDFIR
LVNEGKIIEAAELCHQSSSLPEICGRVCPQDRLCEGACTLKNEGGSVAIGNLERYITDTA
LAMGWRPTIDNVAPRPERVAVIGAGPAGLGCADILVRAGVHVDVFDRHPEIGGLLTFGIP
PFKLDKNVLERRRDVFSAMGVNFHLNQEVGRDVAFADLLKNYDAVFLGVGTYGLMAAGLE
GENAPGVIQALPFLIASTREVMGLEESAEYPLTDIKGKRVVVLGGGDTAMDCLRTAVRRG
AESVTCAYRRDELSMPGSKKEVVNAREEGVKFEFNVQPQRIQLNRKGQVCAVEMIRTKMG
DPGPDGRRRPQPIPDSGFELKADVLIMAFGFQAHEMPWLRGHGIKLDRWGQIVTGGKGRG
TTQTSHDKIFAGGDAVTGADLVVTAIVAGRQAASEMLAQFTAREEI