Protein Info for BWI76_RS17545 in Klebsiella michiganensis M5al

Annotation: oxidoreductase, 4Fe-4S subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF12800: Fer4_4" amino acids 10 to 22 (13 residues), 12.2 bits, see alignment (E = 9.4e-05) amino acids 81 to 95 (15 residues), 18 bits, see alignment (E = 1.3e-06) PF13247: Fer4_11" amino acids 47 to 135 (89 residues), 39.4 bits, see alignment E=2.6e-13 PF00037: Fer4" amino acids 81 to 97 (17 residues), 23.6 bits, see alignment (E = 1.6e-08)

Best Hits

Swiss-Prot: 57% identical to YGFS_ECOLI: Putative electron transport protein YgfS (ygfS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to cro:ROD_33941)

Predicted SEED Role

"Predicted oxidoreductase, Fe-S subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5J4 at UniProt or InterPro

Protein Sequence (158 amino acids)

>BWI76_RS17545 oxidoreductase, 4Fe-4S subunit (Klebsiella michiganensis M5al)
MTRFIVASSQACIGCRTCEVACALEHVAPGAEFHPRLKVMRLDDLSVPVMCHQCENAPCV
GACPTGALSMGAEKVEAEGGRCIGCQSCAIACPFGAIAIEVAAGLTPVIVKCDLCGARER
GPACVDVCPTAALSIMTEEQLSALQKQRNIATAALLSL