Protein Info for BWI76_RS17540 in Klebsiella michiganensis M5al

Annotation: chlorohydrolase/aminohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR03314: putative selenium metabolism protein SsnA" amino acids 4 to 440 (437 residues), 686.4 bits, see alignment E=8.6e-211 PF01979: Amidohydro_1" amino acids 55 to 410 (356 residues), 172.6 bits, see alignment E=7.2e-55

Best Hits

Swiss-Prot: 78% identical to SSNA_ECOLI: Putative aminohydrolase SsnA (ssnA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to cro:ROD_33951)

Predicted SEED Role

"SsnA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5D2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>BWI76_RS17540 chlorohydrolase/aminohydrolase (Klebsiella michiganensis M5al)
MSILILKNATAAQIYPAKVWENVDIAIENDKILAVGPGLCQRYPQAQVKEMRGQLVMPGM
VCSHNHFYSGLSRGIQANIAPSPDFISTLKNLWWRLDRALDEESLYYSGLICAMEAVRSG
CTAVIDHHASPHYITGSLSQLRNAFLKIGLRGMTCFETTDRNFGSRELRDSVEENIRFAR
EIDAAREKGDQPYLVEAHIGAHAPFTVPDEGLAMLGEALKATGRGLHIHAAEDRYDVSHS
HHLYGKDLLARLAEFGLINSKTLIAHGLYISDADVELLNAQDGFLVHNARSNMNNHVGYN
HRLPQIRNLALGTDGIGSDMFEEMKFAFFKHRDAGGPLWPDSFAKALSNGNELLNRNFNA
RFGRLEAGYKADLTLCDYMAPTPLIAENIAGHIAFGLGSNSVRSVMVNGVMIYEDRQFSF
DCEPIFREAQKVAKKMWARMDALPA