Protein Info for BWI76_RS17505 in Klebsiella michiganensis M5al

Annotation: PLP-dependent lyase/thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR03528: diaminopropionate ammonia-lyase" amino acids 6 to 393 (388 residues), 632.5 bits, see alignment E=2e-194 TIGR01747: diaminopropionate ammonia-lyase family" amino acids 23 to 392 (370 residues), 643.6 bits, see alignment E=8.8e-198 PF00291: PALP" amino acids 41 to 348 (308 residues), 167.2 bits, see alignment E=2.9e-53

Best Hits

Swiss-Prot: 82% identical to DPAL_ECOL6: Diaminopropionate ammonia-lyase (ygeX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01751, diaminopropionate ammonia-lyase [EC: 4.3.1.15] (inferred from 88% identity to cro:ROD_34021)

MetaCyc: 82% identical to 2,3-diaminopropionate ammonia-lyase (Escherichia coli K-12 substr. MG1655)
Diaminopropionate ammonia-lyase. [EC: 4.3.1.15]

Predicted SEED Role

"Diaminopropionate ammonia-lyase (EC 4.3.1.15)" (EC 4.3.1.15)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5E9 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BWI76_RS17505 PLP-dependent lyase/thiolase (Klebsiella michiganensis M5al)
MSAFSLKMDIAENRFFNAETSPLFSRQQAQQARRFHQKITGYKPTPLVALNELSALFGVQ
KILVKDESRRFGLNAFKMLGGSYAIARLLCEKYDLDINDLSFETLKSSIKEKMTFATTTD
GNHGRGVAWAARQLGQNAVIYMPKGSAQERVDAILRLGAECIVTDMNYDDTVRFTMQTAQ
NNGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQLSSMGIARPTHVLLQGGVGAMAGG
VLGYLADVYGAKHLHSIIVEPELADCLYRSALKGQMVNVSGDMATIMAGLACGEPNPLGW
EVLRNCATQFVSCQDAVAALGMRVLGNPTGQDPRIISGESGAVGLGLLAAIHFHPQRDAL
MHKLKLDSRSVVLVISTEGDTDVKHYREVVWEGRHPAAQ