Protein Info for BWI76_RS17500 in Klebsiella michiganensis M5al

Annotation: knotted carbamoyltransferase YgeW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR03316: knotted carbamoyltransferase YgeW" amino acids 5 to 393 (389 residues), 670.8 bits, see alignment E=2.8e-206 PF02729: OTCace_N" amino acids 21 to 177 (157 residues), 84.1 bits, see alignment E=1.1e-27 PF00185: OTCace" amino acids 210 to 372 (163 residues), 67 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 92% identical to YGEW_ECOL6: Putative carbamoyltransferase YgeW (ygeW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 93% identity to cro:ROD_34031)

Predicted SEED Role

"Aspartate/ornithine carbamoyltransferase family protein protein YgeW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B593 at UniProt or InterPro

Protein Sequence (395 amino acids)

>BWI76_RS17500 knotted carbamoyltransferase YgeW (Klebsiella michiganensis M5al)
MKTVNELIKDINQLNSHLSEKDFLLTWEQTPDELKQVLDVAAALKTLRAENIATKVFNSG
LGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQIAHGETVRETANMISFCADAIGI
RDDMFLGAGNAYMREVGEALDDGHKQGVLPQRPALINLQCDIDHPTQSMADLAWLREHFG
SLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMEVTLAHPEGYDLIPDVIEVAK
NNAQASGGSFRQVNSMEEAFKDADIVYPKSWAPYKVMEKRTELLRANDHEGLKALEKACL
EQNAGHKDWHCTEEMMKHTRDGEALYMHCLPADITGVSCEAGEVTEGVFEKYRIPTYKEA
SWKPYIIAAMIVCRKYANPGKVLEQLLKDAQKRIK