Protein Info for BWI76_RS17465 in Klebsiella michiganensis M5al

Annotation: C4-dicarboxylic acid transporter DauA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 408 to 438 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 18 to 554 (537 residues), 481.6 bits, see alignment E=1.6e-148 PF00916: Sulfate_transp" amino acids 29 to 411 (383 residues), 260.8 bits, see alignment E=1.9e-81 PF01740: STAS" amino acids 451 to 551 (101 residues), 58.7 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 91% identical to DAUA_ECO57: C4-dicarboxylic acid transporter DauA (dauA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 95% identity to eae:EAE_16705)

MetaCyc: 91% identical to aerobic C4-dicarboxylate transporter DauA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-122A; TRANS-RXN0-553

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5Q0 at UniProt or InterPro

Protein Sequence (559 amino acids)

>BWI76_RS17465 C4-dicarboxylic acid transporter DauA (Klebsiella michiganensis M5al)
MNRLFSSHVMPFRALIDACWKEKYTASRFTRDVIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTSAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLMSGIFLILFG
LARFGRLIEYIPLSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALAMALPT
INPGDAAIGVVTLGTLIIWPRLGIRLPGHLPALLAGCAVMGVVNLLGGHVATIGSQFHYI
LADGSQGNGIPQLLPQLVLPWDMPGSDFTLSWSSLQALLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELIGQGLGNIVAPFFGGITATAAIARSAANVRAGATSPVSAVIHALLV
IMALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVNLLRYAPKDDIIVMLMCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVNVEVPDDVLVLRVIGPLFFAAAEGLFTDL
ETRVAGKRIVVLKWDAVPVLDAGGLDAFQRFVKKLPEGCELRVSNLEFQPLRTLARAGVK
PIPGRLSFYPDRNAALADI