Protein Info for BWI76_RS17450 in Klebsiella michiganensis M5al

Annotation: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 2 to 282 (281 residues), 374.1 bits, E=2.9e-116
• PF00288: GHMP_kinases_N
  • amino acids 91 to 148 (58 residues), 53.9 bits, E=2e-18
• PF08544: GHMP_kinases_C
  • amino acids 214 to 264 (51 residues), 34.6 bits, 2.1e-12

Best Hits

Swiss-Prot: 90% identical to ISPE_KLEP7: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 90% identity to kpn:KPN_02237)

MetaCyc: 82% identical to 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Escherichia coli K-12 substr. MG1655)
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase. [EC: 2.7.1.148]

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See A0A285B570 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BWI76_RS17450 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Klebsiella michiganensis M5al)
MMTRWPSPAKLNLFLYITGRRADGYHTLQTLFQFLDYGDTLTIEPRDDGQLRLLTPVDGV
PDEENLIIRAARLLMQAAAQAGTLPAGSGADISINKVLPMGGGLGGGSSNAATVLVALNH
LWGCNLSEDELAALGLQLGADVPVFVRGHAAFAEGIGEILTPVEPEEKWYLVAHPGVSIP
TPIIFRDPQLPRDTPARSINTLLKCKFGNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESAARQVLEKAPAWLHGFVARGVNISPLKQALR