Protein Info for BWI76_RS17440 in Klebsiella michiganensis M5al

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 418 (415 residues), 550.4 bits, see alignment E=1.4e-169 PF05201: GlutR_N" amino acids 6 to 156 (151 residues), 182.6 bits, see alignment E=8.3e-58 PF01488: Shikimate_DH" amino acids 172 to 306 (135 residues), 169.7 bits, see alignment E=7.3e-54 PF00745: GlutR_dimer" amino acids 320 to 416 (97 residues), 89 bits, see alignment E=4.7e-29

Best Hits

Swiss-Prot: 97% identical to HEM1_KLEP3: Glutamyl-tRNA reductase (hemA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 97% identity to kpu:KP1_3350)

MetaCyc: 92% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B582 at UniProt or InterPro

Protein Sequence (418 amino acids)

>BWI76_RS17440 glutamyl-tRNA reductase (Klebsiella michiganensis M5al)
MTLLALGINHKTAPVALRERVTFSPDTLDQALESLLAQPMVQGGVVLSTCNRTELYLSVE
EQDNLQEVLIRWLCDYHGLNEDDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQ
VKKAFADSSRGHLNVSELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESL
SSVTVLLVGAGETIELVARHLREHKVRKMVIANRTRERAQALADEVGAEVIALSDIDERL
KEADIIISSTASPLPIIGKGMVERALKARRNQPMLLVDIAVPRDVEPEVGKLANAYLYSV
DDLQNIIQHNLAQRKAAAVQAETIVEQEASEFMAWLRAQSASETIREYRSQADQVREELT
AKALAALNQGGDAQEIMQDLARKLTNRLIHSPTKSLQQAARDGDDERLHILRNSLGLE