Protein Info for BWI76_RS17435 in Klebsiella michiganensis M5al

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00019: peptide chain release factor 1" amino acids 1 to 358 (358 residues), 576 bits, see alignment E=1.4e-177 PF03462: PCRF" amino acids 14 to 203 (190 residues), 262.3 bits, see alignment E=2.8e-82 PF00472: RF-1" amino acids 216 to 321 (106 residues), 143.7 bits, see alignment E=2.4e-46

Best Hits

Swiss-Prot: 95% identical to RF1_KLEP7: Peptide chain release factor 1 (prfA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_16730)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5H0 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BWI76_RS17435 peptide chain release factor 1 (Klebsiella michiganensis M5al)
MKPSIVAKLEALYERHEEVQALLGDAATIADQDKFRALSREYAQLSDVARCYTDWRQLQD
DIEAAQMMLDDPEMREMAQEELREAKEKGEQMEQQLQVLLLPKDPDDERNAFVEVRAGTG
GDEAALFAGDLFRMYSRYAESRRWRVEIMSANEGEHGGFKEVIAKISGDGVYGRLKFESG
GHRVQRVPATESQGRIHTSACTVAVMPELPEAEMPDISPSDLRIDTFRSSGAGGQHVNTT
DSAIRITHLPTGIVVECQDERSQHKNKAKALSVLGARIRAAEVSRRQQAEASERRNLLGS
GDRSDRNRTYNYPQGRVTDHRINLTLYRLDEAMEGKLDMLIEPIVQEYQADQLAALSEQE