Protein Info for BWI76_RS17430 in Klebsiella michiganensis M5al

Annotation: protein-(glutamine-N5) methyltransferase, release factor-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 2 to 276 (275 residues), 311.9 bits, E=3.4e-97
• PF17827: PrmC_N
  • amino acids 5 to 73 (69 residues), 74.4 bits, E=5.5e-24
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 23 to 271 (249 residues), 301.9 bits, E=3.7e-94
• PF01135: PCMT
  • amino acids 79 to 167 (89 residues), 25.1 bits, E=9.1e-09
• PF06325: PrmA
  • amino acids 101 to 183 (83 residues), 28.9 bits, E=5.2e-10
• PF10294: Methyltransf_16
  • amino acids 107 to 181 (75 residues), 26.7 bits, E=2.8e-09
• PF13847: Methyltransf_31
  • amino acids 108 to 254 (147 residues), 61.7 bits, E=4.6e-20
• PF05175: MTS
  • amino acids 109 to 191 (83 residues), 66.2 bits, E=1.9e-21
• PF03602: Cons_hypoth95
  • amino acids 109 to 190 (82 residues), 28.5 bits, E=7.3e-10
• PF00891: Methyltransf_2
  • amino acids 112 to 171 (60 residues), 22.3 bits, E=4.8e-08
• PF13649: Methyltransf_25
  • amino acids 113 to 183 (71 residues), 45.2 bits, E=8.1e-15
• PF02390: Methyltransf_4
  • amino acids 113 to 172 (60 residues), 28 bits, E=9.1e-10
• PF08241: Methyltransf_11
  • amino acids 114 to 183 (70 residues), 31.2 bits, E=1.8e-10
• PF08242: Methyltransf_12
  • amino acids 114 to 183 (70 residues), 31.2 bits, E=2e-10

Best Hits

Swiss-Prot: 74% identical to PRMC_ECOLI: Release factor glutamine methyltransferase (prmC) from Escherichia coli (strain K12)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 84% identity to kpu:KP1_3348)

MetaCyc: 74% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

See A0A285B5A8 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS17430 protein-(glutamine-N5) methyltransferase, release factor-specific (Klebsiella michiganensis M5al)
MTFQQWLTQAIARLSQSESPRRDAEILLGHVTGRARTYILAFGETALTAAQAAELETLLS
RRARGEPVAHLVGQREFWSLPLFVSPATLIPRPDTECLVEQALARLSDEPCRILDLGTGT
GAIALALASERPDCRVTAVDVMPDAVALAARNVEHLAIPNVSVLQSDWFSALAGQQFDII
VSNPPYIDETDPHLAQGDVRFEPKTALVAADGGLADLAHIIREGRRYLAAGGVMLLEHGW
TQGQAVRELFREAGYGNIATCHDYGDNERLTLGHYQGEV