Protein Info for BWI76_RS17420 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 99 to 121 (23 residues), see Phobius details PF13369: Transglut_core2" amino acids 34 to 185 (152 residues), 154.1 bits, see alignment E=2.1e-49 PF13371: TPR_9" amino acids 188 to 260 (73 residues), 86.8 bits, see alignment E=7.5e-29

Best Hits

Swiss-Prot: 83% identical to SIRB1_SALTY: Protein SirB1 (sirB1) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_16745)

Predicted SEED Role

"FIG002708: Protein SirB1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5G1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>BWI76_RS17420 hypothetical protein (Klebsiella michiganensis M5al)
MRSLADFEFNKAPLCDGMVLISELIRDDFPTHYVQDELERLLALAQEEIASSWDQERQIE
RLLELFYHDWGFSDSRGVYRLSDVLWLDKVLNNRQGSAVSLGAILLWIAQRLALPVVPVI
FPTQMLLRADPQESEEMWLINPFNGETLNEHTLEVWLKGNISPVAELFNEDLDEADNAEV
IRKLLDTLKSALMEERQMELALRTSEALLQFNPEDPYEIRDRGLIYAQLDCDHVALQDLS
YFVEQCPEDPISEMIRAQINTISHKQITLH