Protein Info for BWI76_RS17385 in Klebsiella michiganensis M5al

Annotation: nitrate regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF08376: NIT" amino acids 41 to 277 (237 residues), 180.4 bits, see alignment E=7.8e-57 PF03861: ANTAR" amino acids 332 to 384 (53 residues), 66.6 bits, see alignment 1.3e-22

Best Hits

Swiss-Prot: 100% identical to NASR_KLEOX: Nitrate regulatory protein (nasR) from Klebsiella oxytoca

KEGG orthology group: None (inferred from 76% identity to kpn:KPN_02224)

Predicted SEED Role

"Response regulator NasT" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5F9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BWI76_RS17385 nitrate regulatory protein (Klebsiella michiganensis M5al)
MNNMAGNTPEVVDWFARARRLQKQQLHQLAQQGTLAGQISALVHMLQCERGASNIWLCSG
GRLYAAECRAGAALVDEQLTRFYAALEPARDAASSALCWRIACAVWYLPQLAALRKRVRD
REIAAEEATGQFSRIIRHLLNIVPQLNDSIDDPQIAGRMVALYSFMQGKELAGQERALGA
LGFARGQFSDELRQQLVDRIDGQQPCFDSFQALAQPPQTALFAEQCQASLEIEQLRRVAC
TRQPPADEGETALRWFCAQTQRLEQLRGVEELLIVDLLNAADALLEGEEPEAQLPPADWQ
EDSIALRLDKQLLPLVRQQAHELQQLSGQLASLKDALEERKLIEKAKSVLMTYQGMQEEQ
AWQALRKMAMDKNQRMVEIARALLTVKALWRVTPKE