Protein Info for BWI76_RS17350 in Klebsiella michiganensis M5al

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 105.9 bits, see alignment E=3.5e-34 PF08281: Sigma70_r4_2" amino acids 153 to 198 (46 residues), 35.9 bits, see alignment 1.2e-12 PF04545: Sigma70_r4" amino acids 153 to 199 (47 residues), 27.7 bits, see alignment 3.8e-10 PF00196: GerE" amino acids 155 to 209 (55 residues), 80.8 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 93% identical to NARL_ECOLI: Nitrate/nitrite response regulator protein NarL (narL) from Escherichia coli (strain K12)

KEGG orthology group: K07684, two-component system, NarL family, nitrate/nitrite response regulator NarL (inferred from 96% identity to esc:Entcl_2056)

MetaCyc: 93% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5B5 at UniProt or InterPro

Protein Sequence (216 amino acids)

>BWI76_RS17350 DNA-binding response regulator (Klebsiella michiganensis M5al)
MSQQERATILLIDDHPMLRTGVKQLISMAPDIQVIGEASNGEQGIAMAEALDPDLILLDL
NMPGMNGLETLDRLREKSLSGRVVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKAL
QQAAAGEMVLSEALTPVLAASLRANRATSDRDISQLTPRERDILKLIAQGLPNKMIARRL
DITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERVF