Protein Info for BWI76_RS17320 in Klebsiella michiganensis M5al

Annotation: respiratory nitrate reductase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00351: respiratory nitrate reductase, gamma subunit
  • amino acids 1 to 225 (225 residues), 410.3 bits, E=1.2e-127
• PF02665: Nitrate_red_gam
  • amino acids 5 to 224 (220 residues), 257.5 bits, E=5.1e-81

Best Hits

Swiss-Prot: 90% identical to NARI_ECOLI: Respiratory nitrate reductase 1 gamma chain (narI) from Escherichia coli (strain K12)

KEGG orthology group: K00374, nitrate reductase 1, gamma subunit [EC: 1.7.99.4] (inferred from 99% identity to kva:Kvar_1972)

MetaCyc: 90% identical to nitrate reductase A subunit gamma (Escherichia coli K-12 substr. MG1655)
1.97.1.-; RXN0-3501 [EC: 1.7.5.1]; 1.7.5.1 [EC: 1.7.5.1]

Predicted SEED Role

"Respiratory nitrate reductase gamma chain (EC 1.7.99.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.99.4)

MetaCyc Pathways

• NADH to nitrate electron transfer (2/2 steps found)
• nitrate reduction III (dissimilatory) (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• nitrate reduction VIII (dissimilatory) (2/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (2/2 steps found)
• nitrate reduction I (denitrification) (1/5 steps found)
• nitrate reduction VII (denitrification) (1/5 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.5.1 or 1.7.99.4

Sequence Analysis Tools

See A0A285B5L8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>BWI76_RS17320 respiratory nitrate reductase subunit gamma (Klebsiella michiganensis M5al)
MHFLNMFFFDIYPYIAGTVFLVGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGIL
GIFAGHFLGMLTPHWMYESFLPIDVKQKMAMIAGGACGVMTLVGGLLLLKRRLLSPRVRA
TTTGADILILSLLMVQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGV
AFIFRVHLVLGMTLFVLFPFSRLVHIWSAPVEYLTRKYQIVRARR