Protein Info for BWI76_RS17285 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02810: SEC-C" amino acids 4 to 19 (16 residues), 21.9 bits, see alignment (E = 1.3e-08) amino acids 134 to 152 (19 residues), 41.8 bits, see alignment (E = 7.6e-15) PF17775: UPF0225" amino acids 30 to 127 (98 residues), 112.5 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 84% identical to Y2103_KLEP3: UPF0225 protein KPK_2103 (KPK_2103) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 86% identity to kpu:KP1_3318)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5E2 at UniProt or InterPro

Protein Sequence (152 amino acids)

>BWI76_RS17285 hypothetical protein (Klebsiella michiganensis M5al)
MSPLCPCGSALEYSSCCQRYLAGAQLAPDPSQLMRSRYSAFVMKDADYLIKTWHPSCQAQ
QFRADLENGFTRTQWHGLTVFAADKGKSPDEGFVSFIARYADDNRSGAIIERSRFLKENG
QWYYIDGTRPLIGRNDPCPCGSGKKFKKCCGQ