Protein Info for BWI76_RS17240 in Klebsiella michiganensis M5al

Annotation: oligopeptide ABC transporter substrate-binding protein OppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00496: SBP_bac_5" amino acids 82 to 463 (382 residues), 331.8 bits, see alignment E=3e-103

Best Hits

Swiss-Prot: 89% identical to OPPA_SALTY: Periplasmic oligopeptide-binding protein (oppA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_16905)

MetaCyc: 86% identical to oligopeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein OppA (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) or Sex pheromones in Enterococcus faecalis and other Firmicutes (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5D1 at UniProt or InterPro

Protein Sequence (543 amino acids)

>BWI76_RS17240 oligopeptide ABC transporter substrate-binding protein OppA (Klebsiella michiganensis M5al)
MTIITKKSLVAAGVLSALMTINAAVAADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGV
PESNINRDLFEGLLVSDLDGHPVAGVAEKWDNKDFKVWTFHLRKDAKWSDGTPVTAQDFV
YSWQRLADPKTASPYASYLQYGHLANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPY
FYKLLVHPSVSPVPKSAIEKFGDKWTQPANIVSNGAYKLKDWVVNERIVLERNTNYWDNA
KTVINQVTFLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPKEVHVDPYLCTYY
YEINNQKAPFTDVRVRTALKMALDRDIIVNKVKNQGDLPAYSYTPPYTDGMKLIEPEWFK
WSQEKRNEEAKKLLAEAGYSADKPLTFNLLYNTSDLHKKLAIAVASIWKKNLGVNVKLEN
QEWKTFLDNRHQGTFDIARAGWCADYNEPTSFLNTMLSDSSNNTSHYKSPAFDKIIAETL
KTSDEGKRADLYAQSEQQLDKDSVIVPVFYYVNARLVKPWVGGYTGKDPLDNTYTRNMYI
VKH