Protein Info for BWI76_RS17235 in Klebsiella michiganensis M5al

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 158 (27 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 228 to 254 (27 residues), see Phobius details amino acids 274 to 300 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 73 (73 residues), 37.4 bits, see alignment E=2.6e-13 PF00528: BPD_transp_1" amino acids 112 to 305 (194 residues), 136.3 bits, see alignment E=1e-43

Best Hits

Swiss-Prot: 97% identical to OPPB_SHIFL: Oligopeptide transport system permease protein OppB (oppB) from Shigella flexneri

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 97% identity to eco:b1244)

MetaCyc: 97% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B571 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BWI76_RS17235 peptide ABC transporter permease (Klebsiella michiganensis M5al)
MLKFIFRRCLEAIPTLFILITISFFMMRLAPGSPFTGERTLPPEVMANIEAKYHLNDPIM
TQYFNYLKQLAHGDFGPSFKYKDYSVNDLVASSFPVSAKLGFAAFFLAVVLGVSAGVIAA
LKQNTKWDFAVMGVAMTGVVIPSFVVAPLLVMIFAITLHWLPGGGWNGGALQYMILPMVA
LSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAF
VGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVI
DPKIRY