Protein Info for BWI76_RS17185 in Klebsiella michiganensis M5al

Annotation: fructosamine kinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF03881: Fructosamin_kin" amino acids 1 to 284 (284 residues), 390 bits, see alignment E=6.6e-121 PF01636: APH" amino acids 24 to 240 (217 residues), 72.1 bits, see alignment E=6.4e-24

Best Hits

Swiss-Prot: 95% identical to YNIA_KLEAK: Putative kinase EAE_16955 (EAE_16955) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: None (inferred from 92% identity to kpn:KPN_02185)

Predicted SEED Role

"Ribulosamine/erythrulosamine 3-kinase potentially involved in protein deglycation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B557 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BWI76_RS17185 fructosamine kinase family protein (Klebsiella michiganensis M5al)
MWQAISNLLSDLHTEAAEIELRNELPGGEIHAAWHLRFGGRDYFVKCDERELLPIFTAEA
DQLELLSRSKTVNVPQVFAVGSDRDYSFLVMEYLPPRPLDAHNAFLLGQQIAHLHQWSDQ
PQFGLDFDNDLSTTPQPNAWQRRWSTFFAEQRIGWQLELAAEKGLHFGDIDSLVDIIQQR
LSNHQPQPSLLHGDLWSGNCALGPNGPYIFDPACYWGDRECDLAMLPLHPEQPPQIYDGY
QSVSPLPSGFLERQPIYQLYTLLNRAILFGGQHLVTAQKALDDVFMDKAP