Protein Info for BWI76_RS17145 in Klebsiella michiganensis M5al

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00168: translation initiation factor IF-3
  • amino acids 15 to 179 (165 residues), 249 bits, E=8.7e-79
• PF05198: IF3_N
  • amino acids 15 to 84 (70 residues), 109.8 bits, E=5.7e-36
• PF00707: IF3_C
  • amino acids 91 to 177 (87 residues), 121 bits, E=1.7e-39

Best Hits

Swiss-Prot: 96% identical to IF3_ECO27: Translation initiation factor IF-3 (infC) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 99% identity to kva:Kvar_2012)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

See A0A285B575 at UniProt or InterPro

Protein Sequence (180 amino acids)

>BWI76_RS17145 translation initiation factor IF-3 (Klebsiella michiganensis M5al)
MKGGKRVQTARPNRINGEIRALEVRLTGLEGEALGIVSLREAIEKAEEAGVDLVEISPNA
EPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVKEIKFRPGTDDGDYQVKLRSLVRFLEE
GDKAKITLRFRGREMAHQQIGMEVLTRVRDDLSELAVVESFPTKIEGRQMIMVLAPKKKQ