Protein Info for BWI76_RS17105 in Klebsiella michiganensis M5al

Annotation: methionine ABC transporter substrate-binding protein MetQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00363: lipoprotein, YaeC family" amino acids 15 to 266 (252 residues), 332.7 bits, see alignment E=8.8e-104 PF03180: Lipoprotein_9" amino acids 28 to 266 (239 residues), 283.3 bits, see alignment E=6.3e-89

Best Hits

Swiss-Prot: 55% identical to METQ_SALTY: D-methionine-binding lipoprotein MetQ (metQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_17035)

MetaCyc: 53% identical to L-methionine/D-methionine ABC transporter membrane anchored binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5I3 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS17105 methionine ABC transporter substrate-binding protein MetQ (Klebsiella michiganensis M5al)
MKKMFSTVLIAASVALLAACSPDEDNKIKVAINTGPDEAIWKVVEQVAKEKYNLDVEVIS
FNDYVLPNEALNNKDVDANAFQTLPYLEAQSKERGYKFAIVGKTFVFPIAAYSKKIKNIS
ELPDGATISISNETTTLGRSLLLLQAQGLIKLKEGTGYLPTTLDIIDNPKQLKIVEVDTP
QLTRTLDDPNVALSIINTNFSAQAGLSAARDGLFMEGPDSPYVNAIVSREENKDSKKVQE
LKEAFQTQAVADKAAEVYKGDAIKGW