Protein Info for BWI76_RS17055 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 202 to 236 (35 residues), see Phobius details amino acids 238 to 271 (34 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 307 to 336 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 344 (330 residues), 192.5 bits, see alignment E=5.5e-61

Best Hits

Swiss-Prot: 79% identical to YDIK_SHIFL: Putative transport protein YdiK (ydiK) from Shigella flexneri

KEGG orthology group: None (inferred from 90% identity to kpe:KPK_2160)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B506 at UniProt or InterPro

Protein Sequence (373 amino acids)

>BWI76_RS17055 hypothetical protein (Klebsiella michiganensis M5al)
MINPNQPRDIPQVLLSVLFLSLIIISCLWVVQPFILSFAWAGTVVIATWPVLLRLQRLLF
GKRALAVLVMTLLLFLLFVIPIALLVNSLVDNSTPLIKVITSGNFTPPDLAWLNSVPLIG
DKLYTGWHNLLEMGGTAIMVKIRPYLGTTTTWFVGQAAHIGKLLVYCGLMLLFSALLYWR
GEQVAYGFRHFATRLASKRGDAAVILAGQAIRAVALGVVVTALAQAVLGGIGLAVSGVPY
AALLTVVMIFTCLVQLGPLLVLVPSIIWLYWSGDTTWGTVLLVWSCVVGTMDNFIRPLLI
RMGADLPMILILSGVIGGLVAFGMIGLFIGPVLLAVSWRLYDAWVNEAPPPPKDPDLVLE
ELSELNTRASQEK