Protein Info for BWI76_RS17020 in Klebsiella michiganensis M5al

Annotation: chaperone protein LpfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00345: PapD_N" amino acids 24 to 138 (115 residues), 131.7 bits, see alignment E=1.5e-42 PF02753: PapD_C" amino acids 161 to 216 (56 residues), 52.1 bits, see alignment E=6.6e-18

Best Hits

Swiss-Prot: 43% identical to LPFB_ECO57: Probable fimbrial chaperone LpfB (lpfB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 76% identity to enc:ECL_02381)

Predicted SEED Role

"FIG00626847: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5C0 at UniProt or InterPro

Protein Sequence (225 amino acids)

>BWI76_RS17020 chaperone protein LpfB (Klebsiella michiganensis M5al)
MRFIRTFGLAMTILTLMQASAIAGVIIGGTRIIFDGAKKEASISVNNPDPTPYLIQSWID
ERDGGAGKTPFIITPPLYRLDSGQKNIERIVATGSLPQTQESLFWVNIKAIPSASKQMNS
LQIAVKTRIKLIYRPVTLRGSTPEEQANKLTWQRSGDELQVNNPTPYVINFNEISVGGKA
LAQVSYVLPASTARFPLPEGAAGNALTFKIINDYGSPGASHQANL