Protein Info for BWI76_RS16985 in Klebsiella michiganensis M5al

Annotation: signal peptide peptidase SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR01981: FeS assembly protein SufD" amino acids 133 to 410 (278 residues), 291.1 bits, see alignment E=3.9e-91 PF01458: SUFBD_core" amino acids 166 to 394 (229 residues), 257.4 bits, see alignment E=6e-81

Best Hits

Swiss-Prot: 75% identical to SUFD_ECOLI: FeS cluster assembly protein SufD (sufD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to eae:EAE_17140)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Z3 at UniProt or InterPro

Protein Sequence (424 amino acids)

>BWI76_RS16985 signal peptide peptidase SppA (Klebsiella michiganensis M5al)
MAGLPNSSNALQQWHHLFESQSGQRSPQAHQHLQQLLRLGLPTRKNENWKYTPLDALLNQ
TFVAAQPQALTAAQRDAQALTVEAWRLVFVDGQFSDSLSDDLAASGYEVQVDNERQHLPD
AVQPEVFLHLTESLATTVTHIRVRRNQRPQKPLLIMHLTRGLASDEMNTAHYRHHLELES
GAQATIIEHYLSLNDQRHFTGARLTMTVADNAHLQHIKLAFENAQSYHFAHNDLALGRDS
SAFSSSFLLGSAVLRHHTSTRLNGENSNLRINSLAMPVNGEVCDSRTWLDHKVGYCNSRQ
LHKTIVNDKGRAVFNGLINVAPHAIKTDGQMTNNNLLLGRLSEVDTKPQLEIYADDVKCS
HGATIGRIDDEQLFYLRSRGITQQAAQQMILYAFAAELTEAIDDEALRQQILARIGQRLP
GGNL