Protein Info for BWI76_RS16970 in Klebsiella michiganensis M5al

Annotation: murein L,D-transpeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01476: LysM" amino acids 43 to 86 (44 residues), 25.7 bits, see alignment 1.3e-09 PF03734: YkuD" amino acids 98 to 233 (136 residues), 84.2 bits, see alignment E=2.1e-27 PF17969: Ldt_C" amino acids 237 to 303 (67 residues), 82.7 bits, see alignment E=3.9e-27

Best Hits

Swiss-Prot: 76% identical to YNHG_ECOLI: Probable L,D-transpeptidase YnhG (ynhG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to kva:Kvar_2140)

MetaCyc: 76% identical to L,D-transpeptidase LdtE (Escherichia coli K-12 substr. MG1655)
RXN-16660

Predicted SEED Role

"L,D-transpeptidase YnhG"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5B3 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BWI76_RS16970 murein L,D-transpeptidase (Klebsiella michiganensis M5al)
MKRASLITLALLSALSASHAAWAVDYPLPPANSRLIGENQFWTVQEGDRNLQAIARRFDT
AAMLILEANDTIAPVQPKPGTQVLIPSQMLLPDVPREGIVVNLAELRLYYFPPGMNQVQV
YPLGIGQQGLETPEMTTRIGQKIPNPTWTPTAGIRARSLEKGIKLPPVVPAGPNNPLGRY
ALRLAYGNGEYLIHGTSAPDSVGLRVSSGCMRMNAADIQALFNQVKSGTPVRIINQPVKF
AVEPDGKRYVEVHRPLTPDESSNAQTMAYTLPAEFHQFAGDKAVDEAQLKRALTRRAGYP
VAISAGESAASGLSVQNTPLDEAKSVQ