Protein Info for BWI76_RS16940 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 23 to 39 (17 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 394 (365 residues), 187.9 bits, see alignment E=1.2e-59

Best Hits

Swiss-Prot: 43% identical to DGOT_ECOL6: D-galactonate transporter (dgoT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08194, MFS transporter, ACS family, D-galactonate transporter (inferred from 88% identity to kpn:KPN_02129)

MetaCyc: 43% identical to D-galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-16

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.27

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Y5 at UniProt or InterPro

Protein Sequence (439 amino acids)

>BWI76_RS16940 MFS transporter (Klebsiella michiganensis M5al)
MNSYSHNQTTAASASGARPSRRRIGILALLAVGTMINYLDRTVLGIAAPQLTAELGIDAA
MMGIVFSAFAWTYALAQIPGGIFLDRFGNKVTYFLALTLWSLFTLFHGMAVGLKSLLLCR
FGLGVSEAPCFPVNSRVVSAWFPQQERAKATAVYTVGEYLGLACFAPLLFWIMGSFGWRA
LFISVGAAGVLFALVWWRCYREPHEDKHLNQLEREHIINGGGMSTGAEQHTAFSWPLVRQ
LLAKRQILGASIGQFAGNTVLVFFLTWFPTYLATERHMPWIKVGFFAIMPFLAAAGGVMF
GGWVSDKLLKATGSANLGRKLPIIAGLLMASTIIAANWLTSDLAVILVMSFAFFGQGMVG
LGWTLISDIAPKGLGGLTGGLFNFCANLAGILTPLIIGFIVAASGNFFYALIYIGGAALL
GVAAYLFILGDVKRIELSQ