Protein Info for BWI76_RS16935 in Klebsiella michiganensis M5al

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 51 to 67 (17 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details PF08501: Shikimate_dh_N" amino acids 14 to 95 (82 residues), 45.8 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 84% identity to kva:Kvar_2147)

MetaCyc: 43% identical to 5-amino-3-dehydroquinate dehydrogenase (Amycolatopsis mediterranei U32)
1.1.1.-

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B566 at UniProt or InterPro

Protein Sequence (278 amino acids)

>BWI76_RS16935 shikimate dehydrogenase (Klebsiella michiganensis M5al)
MVISGNTRLIAHLGYPTAKFKAPMIYNPWLVHQQVDAKVVPMGVKPEDYAAFVPMLFKMT
NIIGALVTMPHKIATCGLVQRLSPTAAIAGACNAIRAEADGTLSGDMFDGEGFVLGIKRK
GFQTRGARALVVGSGGVGSAIAASLAAAGVSALTLYDVRSQTAEALAGRLLQHYPRLDIT
LMRRDPQGHDLVVNATPLGMKEGDPLPLDPQRLTPGTFVGEVVMAQEFTPLLQAARAAGC
PIQRGTDMLFEMIPAYLRFFNLPVATPEQLRELAEIRY