Protein Info for BWI76_RS16930 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF09339: HTH_IclR" amino acids 15 to 63 (49 residues), 45.8 bits, see alignment 1e-15 PF12802: MarR_2" amino acids 20 to 67 (48 residues), 33 bits, see alignment 1.3e-11 PF13412: HTH_24" amino acids 21 to 62 (42 residues), 24.1 bits, see alignment 5.2e-09 PF01047: MarR" amino acids 30 to 69 (40 residues), 28.2 bits, see alignment 3.6e-10 PF01614: IclR" amino acids 135 to 257 (123 residues), 52 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 77% identical to MHPR_ECOLI: DNA-binding transcriptional activator MhpR (mhpR) from Escherichia coli (strain K12)

KEGG orthology group: K05818, IclR family transcriptional regulator, mhp operon transcriptional activator (inferred from 87% identity to kpu:KP1_3218)

Predicted SEED Role

"Mhp operon transcriptional activator" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B508 at UniProt or InterPro

Protein Sequence (268 amino acids)

>BWI76_RS16930 transcriptional regulator (Klebsiella michiganensis M5al)
MDQDASADYKTVRGLSRGLLLLNLLNKFDGGATVGTLAEFSGLHRTTVRRLLETLQDEGY
VRRSRSDDSFRLTIKVRQLSEGFRDEHWISALATPLLGELLREVLWPTDITTLDVDAMVV
RETTHRFSRLSFHRAMVGRRLPLLLTASGLTWLAFAPEHERSPIVEMLAARPEAEYQLAR
EPEKLAAILERTRQNGYGENFRGWQQEEKIASIAVPIRRQLRVIGCLNLVYMAQAMTIDQ
AAQKYLASLQKVAGQIEERMSDEEVFYG