Protein Info for BWI76_RS16920 in Klebsiella michiganensis M5al

Annotation: 3-(2,3-dihydroxyphenyl)propionate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF02900: LigB" amino acids 5 to 306 (302 residues), 215 bits, see alignment E=5.9e-68

Best Hits

Swiss-Prot: 88% identical to MHPB_KLEP3: 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase (mhpB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K05713, 2,3-dihydroxyphenylpropionate 1,2-dioxygenase [EC: 1.13.11.16] (inferred from 89% identity to kva:Kvar_2154)

MetaCyc: 85% identical to 3-carboxyethylcatechol 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
3-carboxyethylcatechol 2,3-dioxygenase. [EC: 1.13.11.16]; 1.13.11.16 [EC: 1.13.11.16]

Predicted SEED Role

"2,3-dihydroxyphenylpropionate 1,2-dioxygenase (EC 1.13.11.-)" in subsystem Cinnamic Acid Degradation (EC 1.13.11.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.- or 1.13.11.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B559 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BWI76_RS16920 3-(2,3-dihydroxyphenyl)propionate dioxygenase (Klebsiella michiganensis M5al)
MNAYLHCLSHTPLVGYVDPEQAVLDEVNGTIADARARIAAFDPELVVLFAPDHYNGFFYD
VMPPFCLGIGATSIGDFSSASGVLPVPTALAEACAHAVIKDGIDLAVSYCMQVDHGFAQP
LEFLLGGLDRLPVLPVFINGVASPLPGFQRTRMLGEAIGRFLTTLNKRVLILGSGGLSHQ
PPVPELAKADAPMRDRLLGSGRQLPPDERELRQQRVISAAKRFIEDQHSLYPLNPVWDNR
FMSLLEQGRLTELDAISNEELSAMAGKSTHEIKTWVAAFAALSAFGRWRCEGRYYRPIPE
WIAGFGSLSAAAQN