Protein Info for BWI76_RS16910 in Klebsiella michiganensis M5al

Annotation: 2-keto-4-pentenoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF01557: FAA_hydrolase" amino acids 57 to 259 (203 residues), 97.1 bits, see alignment E=6.3e-32

Best Hits

Swiss-Prot: 85% identical to MHPD_KLEP7: 2-keto-4-pentenoate hydratase (mhpD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02554, 2-keto-4-pentenoate hydratase [EC: 4.2.1.80] (inferred from 86% identity to kpe:KPK_2204)

MetaCyc: 84% identical to 2-hydroxypentadienoate hydratase (Escherichia coli K-12 substr. MG1655)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]

Predicted SEED Role

"2-keto-4-pentenoate hydratase (EC 4.2.1.80)" (EC 4.2.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5D6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>BWI76_RS16910 2-keto-4-pentenoate hydratase (Klebsiella michiganensis M5al)
MTTLSLEQLAQRLRDAETRGQAIEPLRDTLGVDNAEAAYAIQRMNVQHHVANGRRVVGRK
VGLTHPKVQQQLGVDQPDFGTLFADMCYGDNAEVPFSRVLQPKVEAEIALLLKRDLPHAD
TTFDELYAAIDWVLPALEVVGSRIRDWSIGFVDTVADNASCGVYVLGSPARRPDGLDLKN
CAMRMTRNEEEVSSGRGSECLGHPLNAAVWLARKMASLGEPLRAGDIVLTGALGPMVAIN
AGDRFEAHIDGLGSVAATFVAQEEGSHE