Protein Info for BWI76_RS16905 in Klebsiella michiganensis M5al

Annotation: acetaldehyde dehydrogenase (acetylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03215: acetaldehyde dehydrogenase (acetylating)
  • amino acids 3 to 308 (306 residues), 466.4 bits, E=1.7e-144
• PF01118: Semialdhyde_dh
  • amino acids 5 to 119 (115 residues), 50.2 bits, E=3.3e-17
• PF09290: AcetDehyd-dimer
  • amino acids 131 to 284 (154 residues), 205.4 bits, E=4.1e-65

Best Hits

Swiss-Prot: 94% identical to ACDH_KLEP3: Acetaldehyde dehydrogenase (mhpF) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 93% identity to kpu:KP1_3213)

MetaCyc: 90% identical to acetaldehyde dehydrogenase (acetylating) MhpF (Escherichia coli K-12 substr. MG1655)
Acetaldehyde dehydrogenase (acetylating). [EC: 1.2.1.10]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of L-threonine metabolism (18/18 steps found)
• mixed acid fermentation (16/16 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• superpathway of purine deoxyribonucleosides degradation (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
• ethanolamine utilization (5/5 steps found)
• mandelate degradation to acetyl-CoA (14/18 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (3/3 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• L-threonine degradation IV (2/2 steps found)
• ethanol degradation I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• catechol degradation I (meta-cleavage pathway) (4/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
• catechol degradation II (meta-cleavage pathway) (4/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (4/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• 2-aminoethylphosphonate degradation I (1/3 steps found)
• sulfoacetaldehyde degradation IV (1/3 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• p-cumate degradation (3/8 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (9/17 steps found)
• triethylamine degradation (1/6 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• p-cymene degradation (3/11 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.10

Use Curated BLAST to search for 1.2.1.10

Sequence Analysis Tools

See A0A285B564 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BWI76_RS16905 acetaldehyde dehydrogenase (acetylating) (Klebsiella michiganensis M5al)
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPESDGLARARRMGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHVKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLEAN
LAEGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASIASKSAGPGTRANIDEFTETTSQ
AIEKVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSEAASQQDIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDKPVNLPGVGRFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEKMAQAMNDAAGEAA