Protein Info for BWI76_RS16875 in Klebsiella michiganensis M5al

Annotation: putative type I cysteine dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 64% identical to 3MDO_PSEAE: 3-mercaptopropionate dioxygenase (PA2602) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_17230)

MetaCyc: 54% identical to 3-mercaptopropionate dioxygenase (Variovorax paradoxus)
RXN-15364 [EC: 1.13.11.91]

Predicted SEED Role

"Cysteine dioxygenase (EC 1.13.11.20)" (EC 1.13.11.20)

MetaCyc Pathways

L-cysteine degradation I (2/3 steps found)
taurine biosynthesis I (1/3 steps found)
superpathway of L-methionine salvage and degradation (10/16 steps found)
3,3'-disulfanediyldipropannoate degradation (1/4 steps found)
3,3'-thiodipropanoate degradation (1/4 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.20 or 1.13.11.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B586 at UniProt or InterPro

Protein Sequence (198 amino acids)

>BWI76_RS16875 putative type I cysteine dioxygenase (Klebsiella michiganensis M5al)
MTAPRMEKLRQFIQDLDALHREFADETALLDAVALRLAALVKKDDWLPEEYTLPHPHHYQ
QYLLHVDSGQRFSIVSFVWGPGQSTPIHDHRVWGAIGMLRGAEENQRYRLDERGLPVISG
VAERLSPGEVEKVSSRDGDIHRVSNALTDRVSISIHVYGGNIGGVRRAVYTPEGLVKPFV
SGYSNRHLPNIWDLSKDN