Protein Info for BWI76_RS16855 in Klebsiella michiganensis M5al

Annotation: putative ABC transporter periplasmic solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 30 to 311 (282 residues), 207 bits, see alignment E=1.8e-65 PF13379: NMT1_2" amino acids 55 to 241 (187 residues), 49 bits, see alignment E=1.8e-16 PF12974: Phosphonate-bd" amino acids 66 to 235 (170 residues), 54.4 bits, see alignment E=3.4e-18 PF09084: NMT1" amino acids 68 to 187 (120 residues), 59.9 bits, see alignment E=8.4e-20 PF00497: SBP_bac_3" amino acids 101 to 202 (102 residues), 26.9 bits, see alignment E=8.5e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to eae:EAE_17250)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B554 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BWI76_RS16855 putative ABC transporter periplasmic solute-binding protein (Klebsiella michiganensis M5al)
MRKLHFTRVAGALMLLVLSGYTAAQERITLRIADQKGGMRSQLEAANALRELPYEIKWAE
FPAAAPLAEALNAGAVDAGIIGDAPLLFALANGAPVKAIAVDKSNPAGTAVLVSPDSALK
SAADLKGKRIATGKGSIGHFVALKALEQAGISPKEVQWVFLGPVDAKVALLNGSVDAWAT
WEPYTTQLVKTAEGKILVSGKGLLPGNTFLAATDDALKDPQKRAALQDYLTRLAGAERWA
YANLDSYGKTLGEIIRFPADIARAQFANRQSQWQPLDAQTVAQQQSTANFYLANGLIRAK
LDVTPTFDNGFSVPAAQAHAEVAP