Protein Info for BWI76_RS16850 in Klebsiella michiganensis M5al

Annotation: ABC transporter periplasmic substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF13379: NMT1_2" amino acids 60 to 272 (213 residues), 58.9 bits, see alignment E=6.9e-20 PF09084: NMT1" amino acids 64 to 273 (210 residues), 57.1 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 96% identity to eae:EAE_17255)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4V5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>BWI76_RS16850 ABC transporter periplasmic substrate-binding protein (Klebsiella michiganensis M5al)
MMKAAFSRRRFLRLTGGLALAGASLPLWAHDMAAMASGDEHPALRLAQPYKIKLAINKSA
VCLAPVAVAEQQKIFSKYNLDVEFVNFGNSTDVLLEAIATGKADAGVGMALRWLKALEQG
FDVKLTAGTHGGCLNLLTAKNSPFGGLESLKGQTIGVTDMAGPDKNFFAILLKRHGIDPI
SDVQWKVYPADLLSVALDKREIAAISGSEPFSYRLLATGKYQLIASNMTGDYANLSCCVL
GVSGSLARDHKPAAAALTQAILEAHSYAAAHPESVAQSFLAHALNTNEAEVSGILHGQGH
GHHAVGEAFVKELTQYAVDLQRVQVIKPGTDPHQFAESIYVNVFA