Protein Info for BWI76_RS16845 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 134 to 160 (27 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 240 to 271 (32 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 149 to 310 (162 residues), 61.7 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to kpe:KPK_2216)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B511 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BWI76_RS16845 ABC transporter permease (Klebsiella michiganensis M5al)
MSTFSPERALARTTSGRPLWTEGLLAAALWLLGGLFTLAWPDAGRRWPFSEGWALAQFTL
GGGLLLLALSYRYWRQRGARLQHAGKWLALLPVLFALWEGLTAKTAFLPVPFFAPPQALI
EVLYDDWPRLLDSLLHSLGLLGLGVLLGTSCGFISGLAIGWSQRIGYWVHPVLRLLGPVP
STALLPLCLFIFPSSFGASVFLIALSTWFPVTVLTWSGVIGIDKAWYDVARTLGASQRFL
ILRVAIPAALPNVFVGLFMGLGASFSVLIVAEMVGVKSGIGFYLQWAQGWAAYPNMYAAL
LVMALLCSGLISGLFMVRDRLLSWQRGGMQW