Protein Info for BWI76_RS16825 in Klebsiella michiganensis M5al

Annotation: heme ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 275 (28 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details PF01032: FecCD" amino acids 26 to 338 (313 residues), 283 bits, see alignment E=1.4e-88

Best Hits

Swiss-Prot: 43% identical to FEPD_ECOLI: Ferric enterobactin transport system permease protein FepD (fepD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_17280)

MetaCyc: 43% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Putative iron compound permease protein of ABC transporter family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4V9 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BWI76_RS16825 heme ABC transporter (Klebsiella michiganensis M5al)
MSASALLLPRRQSRPRLALVLLSLLLLGGSLVHLGLGARWIAPQTVLQALFHYDPRNFDH
RIIVDLRLVRLAAALLTGAALGVAGLLLQTVIRNPLGEPHILGLNAGASLAVVATSALGI
SLGGVALARPLTAACGAALLFGGVMLLSSSGRGGVTPLRITLCGVALSAFASAVTAAILI
LDEQTLLAMRTWLAGDLAGLNWQTLRAALLPALAGVTVALAIAPRLNVLALGDKVALGLG
VKIVQTRLLGLAAIALLCGSAVAVAGPIGFVGLVVPHAVRRLISEDIRLALPLAAPVGAL
VLLLADIAARTLVAPQELATGAMTALVGAPVFIFIAARFFK