Protein Info for BWI76_RS16820 in Klebsiella michiganensis M5al

Annotation: iron ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details PF01032: FecCD" amino acids 37 to 345 (309 residues), 263.8 bits, see alignment E=9.7e-83

Best Hits

Swiss-Prot: 35% identical to FECD_ECOLI: Fe(3+) dicitrate transport system permease protein FecD (fecD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 88% identity to eae:EAE_17285)

MetaCyc: 35% identical to ferric citrate ABC transporter membrane subunit FecD (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"putative permease of ferrichrome ABC transporter"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5B7 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BWI76_RS16820 iron ABC transporter (Klebsiella michiganensis M5al)
MKSAARRAGFRPLACGGRHFLLRPAALKIAAGMLLVILLLALFGLTRGSFPMPSGTLFRA
LLGAENVAEQPRFILFDIRLPRLLMALLCGAMLGLAGAAMQSITRNGLADPGLIGVKEGA
SIVVLALVLFFPAVGVIWRPLAGMLGGVLVALLVLALARDCSRPRFILIGIGVSWTLAAA
VGIFMTTADVRDVQTAMIWLAGSLHAATWPLLAVAFCWALPGAMILFLTARAADAALLGD
RTAIGLGVRLQQLTLLRFFAPVLLTSASVSCVGSLGFVGLMAPHMARFLLRGGQVALLCG
SALIGALLVLATDTIGRLAFAPLQIPAGIVIALVGCPFFIVLLWRRRDAL