Protein Info for BWI76_RS16805 in Klebsiella michiganensis M5al

Annotation: basic amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 27 to 246 (220 residues), 212.6 bits, see alignment E=5.2e-67 PF10613: Lig_chan-Glu_bd" amino acids 41 to 117 (77 residues), 40.5 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 42% identical to HISJ_NEIGO: Probable histidine-binding protein (hisJ) from Neisseria gonorrhoeae

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 90% identity to kpu:KP1_3189)

Predicted SEED Role

"Glutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)" (TC 3.A.1.3.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B502 at UniProt or InterPro

Protein Sequence (255 amino acids)

>BWI76_RS16805 basic amino acid ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MVKNWMKACCLVAAMIGTAHAAQQTYVVGSGGTYRPFEFENSQKQLEGFDIDIIKAIAKA
EGFDIKLVNTPWEGIFATLSTGDRDIIISGITITDKRKQMVDFSAPYFPAEQSIVVPADS
KVTSLEALKSEKVGVVNSSTGDIVVSDVLGKNSTSIKRFDNTPLMLQELFEDGVSAAVGD
VGVVKYYIKQHPEKQFKLVPDAKFERQYFGIAVAKGNSELQAKINAGLQKIIADGTYAKI
YKTWFDDNVPTLPAQ