Protein Info for BWI76_RS16800 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 65 to 72 (8 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 199 to 202 (4 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 64 to 248 (185 residues), 89.9 bits, see alignment E=9.1e-30

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to kpe:KPK_2226)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4V3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>BWI76_RS16800 amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MTGFRWEIIEEYGPLFMDGALMTIKCTIICVILGTLWGLTLGLGRMAKAEHGVWKYVLRY
LVQFPVRFYVSAFRGTPLFVQIMVVHFALVPLFINPRDGLLVTSGMMSADFARELRSNYG
AFLSCIVAITLNAGAYVSEIFRAGIQSIDKGQMEASRALGMPWWKTMRQVILPQAFRRIL
PPLGNNAIAIVKDSSLASAIGLADLAYAARTVSGAYATYWEPYLTISLVYWVITFLLAQL
VNRLEKRFGKSDSH