Protein Info for BWI76_RS16795 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 60% identical to GLNQ_BACSU: Glutamine transport ATP-binding protein GlnQ (glnQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 95% identity to kva:Kvar_2178)

MetaCyc: 57% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"transport; Transport of small molecules: Cations"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B543 at UniProt or InterPro

Protein Sequence (240 amino acids)

>BWI76_RS16795 amino acid ABC transporter ATPase (Klebsiella michiganensis M5al)
MIHINNLHKRFGDSHVLRGISCDIKPQEVVCIIGPSGSGKSTFLRCMNALETVSEGEVEV
NGFAAHDRATDLNKMRESVGMVFQRFNLFPHKTVLENLIMAPMNLRGMARAEAVRLAEEL
LAKVGLSDKRDAWPSSLSGGQQQRVAIARALAMKPSIMLFDEPTSALDPELVGDVLEVMK
NLASEGMTMVIVTHEMGFAREVADRVIFIDQGIIQEEGKPAQIFSAPTNPRTAAFLSKVL