Protein Info for BWI76_RS16790 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 352 (28 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 241 (225 residues), 50 bits, see alignment E=2.1e-17 amino acids 206 to 375 (170 residues), 73.4 bits, see alignment E=1.6e-24 PF06779: MFS_4" amino acids 36 to 370 (335 residues), 36.8 bits, see alignment E=3.2e-13

Best Hits

KEGG orthology group: None (inferred from 82% identity to eae:EAE_17315)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4X3 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BWI76_RS16790 MFS transporter (Klebsiella michiganensis M5al)
MFNPEQNRLAPTLAMIMAASLVGFITGYTVPLISLELAQQQIDTVYVGLLAALPPAGMMI
SSFLSPALCRRFEMGLLLSVSLVALAAATIASCLSFDMVHLLLPRLVTGLASGVIIVIGE
SWITGGAAGKNRATLTGIYASAFTGCQLAGPLLISAGEAYQSWTLLLVGLVTLACLLMLR
HLPSGSRERLAERASWRSLGAFLPVLASGVFCFAFFDASILALLPLYGMDKGLSEVTAVL
LVTVVLTGDAVFQAPLGWIADRFGIRRVHLTCAVVFCLALLALPFLLASHIQLIVGCLLL
GAAAGALYTLSLVRAGKTFSGQKLIMINALLGFFWSAGSVAGPVVSGLLISVAGYDGLLM
TLFVSGALFLLIQCLGKSEKALLADEREREEEMDDISEAAQ