Protein Info for BWI76_RS16775 in Klebsiella michiganensis M5al

Annotation: malate/lactate/ureidoglycolate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF02615: Ldh_2" amino acids 8 to 338 (331 residues), 358.9 bits, see alignment E=1.3e-111

Best Hits

Swiss-Prot: 72% identical to HCXB_ECO57: Hydroxycarboxylate dehydrogenase B (hcxB) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 85% identity to eae:EAE_17445)

MetaCyc: 72% identical to hydroxycarboxylate dehydrogenase B (Escherichia coli K-12 substr. MG1655)
Hydroxyphenylpyruvate reductase. [EC: 1.1.1.237]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.237 or 1.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4V0 at UniProt or InterPro

Protein Sequence (360 amino acids)

>BWI76_RS16775 malate/lactate/ureidoglycolate dehydrogenase (Klebsiella michiganensis M5al)
MQTGHRFQATDLHQFVKTLFTHMGSSPTEASLIADHLIAANLAGHDSHGVGMIPSYVRSH
AQGYLQLNRHASVMKDAGAVVTLDGNGGFGQVVAHEAMQIGIEKAKQHGLAAVALRNAHH
IGRIGYWAEQCAAAGMISIHFVNVVGNVMVAPFRGKDSRFGTNPLCVVFPRVGHPPLLLD
YATSAIAFGKTRVAWHKGVPVPAGSLIDARGVPTTDPAVMQTSPLGALLTFAEHKGYALA
TLCEAIGGAVSGGKTSHQETLQGSVDAIFNCMTTIILSPEAFDAPDMQRETEAFIDWCKQ
SPHEPDAPILAPGEWEEANRRQRLAQGIPLDAGSWQAICAAAEEVGVPADTLAQLRQKLA