Protein Info for BWI76_RS16770 in Klebsiella michiganensis M5al

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 47 to 302 (256 residues), 40.3 bits, see alignment E=6.4e-14 PF01547: SBP_bac_1" amino acids 51 to 298 (248 residues), 44 bits, see alignment E=5.9e-15 PF13416: SBP_bac_8" amino acids 59 to 307 (249 residues), 63.8 bits, see alignment E=4.5e-21 PF13343: SBP_bac_6" amino acids 135 to 313 (179 residues), 42.4 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_17450)

Predicted SEED Role

"Putative ABC transporter, periplasmmic iron binding protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B5B2 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BWI76_RS16770 extracellular solute-binding protein (Klebsiella michiganensis M5al)
MYMKISGLMISLTAIFSGQVLATVPEGYPADYQKVVDAGIKEGKVVIYSTTDTKAAGPLI
KGFEAQYPGIKVEYNDMNSTELYNRYISEQAAGGGSGDVVWSSSMDTALKLATEYAEEYA
SPERDKLPKWAVWQQKAYGTTYEPVVFIYNKRLIPQGDVPDSHTALAKLISAQADKFKGK
VTTYDIEKSGLGFMLAVQDSKADANYFNDLAGIAKGGLTVQSSTGTMMERVSSGENLIGY
NILGSYAEARAKTDPSLGISYPKDYVLVLSRVSFITAEAEHLNAAKLWFDYVLSEKGQSI
LANQADIPSLRNDIEGKNDIDGMTKMLGSALKPIPVDETLLAYLEPKQRLEFIKQWRTAA
AK