Protein Info for BWI76_RS16735 in Klebsiella michiganensis M5al

Annotation: cold-shock protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF00313: CSD" amino acids 5 to 69 (65 residues), 70.4 bits, see alignment E=4.6e-24

Best Hits

Swiss-Prot: 74% identical to CSPH_ECOL6: Cold shock-like protein CspH (cspH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 74% identity to ecs:ECs1144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B562 at UniProt or InterPro

Protein Sequence (70 amino acids)

>BWI76_RS16735 cold-shock protein (Klebsiella michiganensis M5al)
MFQKMTGIVKAFDNKTGKGLIIPSDGRKDVQVHISALSPGEPTTISPGIRVEFRRVNGLR
GPTAANVYLS