Protein Info for BWI76_RS16730 in Klebsiella michiganensis M5al
Annotation: cystathionine gamma-lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to METC_COXBU: Cystathionine beta-lyase (metC) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
KEGG orthology group: K01758, cystathionine gamma-lyase [EC: 4.4.1.1] (inferred from 55% identity to ppg:PputGB1_4124)MetaCyc: 46% identical to cystathionine gamma-lyase (Helicobacter pylori 26695)
Cystathionine gamma-lyase. [EC: 4.4.1.1]
Predicted SEED Role
"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
- superpathway of L-threonine metabolism (18/18 steps found)
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-threonine degradation I (6/6 steps found)
- L-methionine biosynthesis I (5/5 steps found)
- homocysteine and cysteine interconversion (4/4 steps found)
- D-serine degradation (3/3 steps found)
- L-cysteine degradation II (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-tryptophan degradation II (via pyruvate) (3/3 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (5/7 steps found)
- L-methionine degradation II (2/3 steps found)
- purine nucleobases degradation II (anaerobic) (17/24 steps found)
- hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
- glycine betaine degradation III (4/7 steps found)
- superpathway of L-methionine salvage and degradation (10/16 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glycine betaine degradation I (4/8 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- hypoglycin biosynthesis (4/14 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Methionine metabolism
- Nitrogen metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.48, 4.4.1.1
Use Curated BLAST to search for 2.5.1.48 or 4.4.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285B518 at UniProt or InterPro
Protein Sequence (395 amino acids)
>BWI76_RS16730 cystathionine gamma-lyase (Klebsiella michiganensis M5al) MKTRTKDIATLAVHAGNQSDPVTHAIFTPIVTASSFIQPNLYEGGDFCYSRVSNPTRKAY ESALAELEGGIYATATASGMAATNIVMELLPKDAHIIAMKGVYGGTWRLFEKLKTHTTGV TISYIDLNDEQSLINTIQENTALIWIETPTNPLLELVDIAKVCRIAKERAITTCVDNTFA SAWNHKPLEMGADMVMLSTSKYVGGHSDLIGGAVITNNEALASRLDFIKTTLGSIASPFD AYLALRGMKTLDLRMARQCGNALRVAQYLENHPAIASVYYPGLPSHPQHQLCRQQMRSGG AVVTATLKGDIQSLKRFIGGLHYFVLAESLGGVESMINHSASMSHGAMSKEEREAIGVYD TTLRFSVGIEHIDDLLQDLESAFAAMDITQDNHHA