Protein Info for BWI76_RS16725 in Klebsiella michiganensis M5al

Annotation: Na+/H+ antiporter NhaC-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 6 to 55 (50 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 149 to 177 (29 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 354 to 381 (28 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 412 to 412 (1 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 177 to 470 (294 residues), 128.4 bits, see alignment E=1.8e-41

Best Hits

Predicted SEED Role

"COG1757: Na+/H+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4U0 at UniProt or InterPro

Protein Sequence (472 amino acids)

>BWI76_RS16725 Na+/H+ antiporter NhaC-like protein (Klebsiella michiganensis M5al)
MHDYGIWTIITPLVTIILAILTRQVILSLLTGIFVGYAVINHSIIQGIGGTLNGIIETFA
SAGNARTIVFMVMIGGIMRLIVVTGGVRKLVQFLSEKNDFVTNKKSVQLLAMLVTSLIFI
ESSINQLIAGASTKNLARRYKVSPEKMSYIIQTSCVSVCSSVMINGWGAAMMGVIGVQIA
QGYLTGEPFEVLASSMIWNTMAWFSLASVLFYILSGCSWGPMKKAELKFETALMEIEQEQ
GADEADPVIDHPACHSLLNFFIPILSTVLMVPVVLYITGDGQFSKGSGSMSVYSGVMFGT
VVSFIWFRARGILNVENFFKELYIGYASMVKISSIMILAFLMGHISAELNTGQYIASITS
GVIPSGFSIGFIFLIAAVMSLATGTSWGTFAIMIPIGVQLGVSLGIDPHFMIGAAISGSI
FGDMTSPISSDAIVASMATNCDHIEHIRTQMPYALVTGSLALMVYLIVGFTL