Protein Info for BWI76_RS16685 in Klebsiella michiganensis M5al

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 73 (73 residues), 32.1 bits, see alignment E=1.1e-11 PF00528: BPD_transp_1" amino acids 111 to 316 (206 residues), 145 bits, see alignment E=2.2e-46

Best Hits

Swiss-Prot: 37% identical to Y1283_MYCTO: Putative peptide transport permease protein MT1320 (MT1320) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_17585)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4T3 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BWI76_RS16685 peptide ABC transporter permease (Klebsiella michiganensis M5al)
MRNFILRRLLQTLPMLLLASFIIFMLFAKTPGDFIDGNITLTAARAAELKAIYGLDQPLL
TRYLHWLGQLLRGDLGFSLQYQIPVSQLLNQYIWNSFLLASVALVFYWGIGLTVGVISAL
KPNSAFDHLVSVAVFAAMSFPTFFLCLLLIKWFAVDLHWLPVGGMTNTGSDDSGWEYVLQ
VAAHLALPVLALVMLQAGSLTRYFRASMLEVVKMDFIRTARAKGLRERTVILKHALRNAL
LPIITLLGFELPGLFSGAIITEKVFNWPGAGHIHIDSLAARDYPVLMGFTLFLAVLTILG
NLIADVLYAWADPRIRVRS