Protein Info for BWI76_RS16665 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 62 to 89 (28 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 38 to 220 (183 residues), 63.1 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 47% identical to METI_SALTY: D-methionine transport system permease protein MetI (metI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 90% identity to kpe:KPK_2321)

MetaCyc: 46% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4X4 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BWI76_RS16665 ABC transporter permease (Klebsiella michiganensis M5al)
MNGALAFFAAIDWGDVAQASLDTLTMLGWSLGFTVLIGLPLGIVLYLSGQPRLLHAPRLY
RLLSLGVNVLRSLPFIILLIVMIPVTTLITGTSLGVEGTIPPLVVGCAPFFARLVETALR
EVEHGLVEASWSMGGNTWQLIWHTLLPESRAGLIAAVTVTAILLVDYTSMAGVIGGGGLG
DLAIRFGYQRFQTDVMVITVLLLIALVQIVQMSGDRLVKAMSRK