Protein Info for BWI76_RS16640 in Klebsiella michiganensis M5al

Annotation: threonine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details PF01810: LysE" amino acids 15 to 204 (190 residues), 122.4 bits, see alignment E=8.5e-40

Best Hits

KEGG orthology group: K05835, threonine efflux protein (inferred from 90% identity to kva:Kvar_2284)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4Z9 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS16640 threonine transporter (Klebsiella michiganensis M5al)
MFLSSLMALAAVLIMGVISPGPSFIYVARNAVARSRTHGLVTALGTGAGAAIFSIMAMLG
LQKVLTAVPEMFIGLKVAGGLYLLWLGYKIYRGAAQPMDFAAGGMAAEHSLLKTFRDGLY
TQLSNPKTALVFASIFTALLPERIPLAFYYIVPLMSFVIDVSWYSLVALVLSSARPRGVY
LRMKRKIDIVTATVLGALGLRLIATSLSK