Protein Info for BWI76_RS16565 in Klebsiella michiganensis M5al

Annotation: YciE/YciF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF05974: DUF892" amino acids 5 to 156 (152 residues), 168 bits, see alignment E=8.8e-54

Best Hits

Swiss-Prot: 82% identical to YCIE_ECOLI: Protein YciE (yciE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to kva:Kvar_3209)

Predicted SEED Role

"Protein YciE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4P6 at UniProt or InterPro

Protein Sequence (168 amino acids)

>BWI76_RS16565 YciE/YciF family protein (Klebsiella michiganensis M5al)
MNHLEHYHDWLRDAHAMEKQAESMLESMAGRIDNYPDLRSRIEQHVTETKRQITVLEEIL
DRNNISRSVLKDSMSKMAAFGQSIGGMFPSDEIVKGSISGYVFEQFEIACYTSLLAAANK
AGDVASIPAIESILAEERAMADWLLKHIPQTTEEFLLRSEAEGVEAKK