Protein Info for BWI76_RS16530 in Klebsiella michiganensis M5al

Annotation: riboflavin synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 204 (204 residues), 290.4 bits, E=2.6e-91
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 77.2 bits, E=4.2e-26
  • amino acids 100 to 185 (86 residues), 85.8 bits, E=8.5e-29

Best Hits

Swiss-Prot: 89% identical to RISA_ECOLI: Riboflavin synthase (ribC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_17765)

MetaCyc: 89% identical to riboflavin synthase (Escherichia coli K-12 substr. MG1655)
Riboflavin synthase. [EC: 2.5.1.9]

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

See A0A285B521 at UniProt or InterPro

Protein Sequence (213 amino acids)

>BWI76_RS16530 riboflavin synthase subunit alpha (Klebsiella michiganensis M5al)
MFTGIVQGTAKVVAIDEKPNFRTHVVELPEHMLAGLETGASVAHNGCCLTVTDINGPRVS
FDLMKETLRITNLGAIREGDSVNVERAAKFSDEIGGHLMSGHIMTTAEVVKILTSENNRQ
IWFKVQDPTLMKYILYKGYIGVDGISLTVGEVTPTRFCVHLIPETLQRTTLGVKKLGDRV
NIEIDPQTQAVIDTVERVLAAKEAEAALKTTAE